PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7NG015800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 684aa    MW: 75691.5 Da    PI: 5.9045
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7NG015800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox51.81.4e-1670121556
                          SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           +f+++q++eLe+ F+ + +++ ++r+eL +k++L+e qV++WFqNrR  +k
  Pavir.7NG015800.1.p  70 KRFSAQQVQELEAKFQVCTHLDPRARQELGRKVSLEEWQVRFWFQNRRSSMK 121
                          57**********************************************9988 PP

2START81.22.4e-262144523205
                          HHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEE CS
                START   3 aeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetlakaetl 82 
                          ae+a++e++ +a+ ++p+W+        +++++ l +f+           + +ea r++ +  +++++lv++l d+  ++d    + +t 
  Pavir.7NG015800.1.p 214 AERALKEFIMLATKGQPMWMPTIdgeVLSDREYDLHTFPG--LlglcprgFIVEATRETDMIKGDAVDLVRILTDVVHRYDVL-SSSST- 299
                          7899*******************66555677777777743..157999999**************************444432.22333. PP

                          EEECTTEEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCE....... CS
                START  83 evissggalqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksngh....... 161
                             s++g +qlm  el + sp  p R++ f+R+++ + + +w++vdvSvd ++  ++    ss++  +llpSg+lie +s+g        
  Pavir.7NG015800.1.p 300 -SSSQDGLIQLMDVELWVQSPRLPpRNVKFLRFRKMMAERKWAVVDVSVDGNNGDEQessGSSYAGYRLLPSGCLIENMSGGFaspsnlr 388
                          .45778***************8888*************************998888776788999999********************** PP

                          ....................EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                START 162 ....................skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                                               +vtwv h ++ ++++++l+r++++sg+a+ga +w++ lqrqce
  Pavir.7NG015800.1.p 389 iyviqilcevfnirsliiifLTVTWVVHGEYLEATVPELFRQFYRSGQAFGACRWLRSLQRQCE 452
                          ********************99*****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-1743121IPR009057Homeodomain-like
SuperFamilySSF466895.56E-1557121IPR009057Homeodomain-like
PROSITE profilePS5007114.94963123IPR001356Homeobox domain
SMARTSM003891.2E-1266127IPR001356Homeobox domain
CDDcd000867.35E-1367123No hitNo description
PfamPF000464.9E-1470121IPR001356Homeobox domain
PROSITE profilePS5084821.296203456IPR002913START domain
SuperFamilySSF559614.94E-10210380No hitNo description
PfamPF018524.7E-20214452IPR002913START domain
SuperFamilySSF559614.94E-10408452No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MENEGQLNNN NEQDLDLTIG NHAAWNQPVE YNLDDLLGAE DHHADTNNQR SDDDEDRRPE  60
SGTTPSKRAK RFSAQQVQEL EAKFQVCTHL DPRARQELGR KVSLEEWQVR FWFQNRRSSM  120
KLKACGNEIR EMQLENTKLR AENIELKQLI QNPTCFRCRD PTGANQLASE NIIREAGRPD  180
QSVSSEHHQA SAYMRPVPVT YSCRTNKAAL VSHAERALKE FIMLATKGQP MWMPTIDGEV  240
LSDREYDLHT FPGLLGLCPR GFIVEATRET DMIKGDAVDL VRILTDVVHR YDVLSSSSTS  300
SSQDGLIQLM DVELWVQSPR LPPRNVKFLR FRKMMAERKW AVVDVSVDGN NGDEQESSGS  360
SYAGYRLLPS GCLIENMSGG FASPSNLRIY VIQILCEVFN IRSLIIIFLT VTWVVHGEYL  420
EATVPELFRQ FYRSGQAFGA CRWLRSLQRQ CEYMAALGSS HVPSSSSSSS SSGAAMSPLG  480
KRGVLELARR MKESFYAAVS GPVTMASTNI VDQWCVSSGT GAERVGAAVR MVTWNCAEIM  540
PGEPAITVLS ATTTVRLPGT PPLRVFEYIC NLQRRGEWDN FVNGGPVEEV SHVATSARVH  600
GNSVSILRPT VVADGSHETN SNMLILQHSS TDASGSLVVY SLIEENVMRG IMGGADNSIF  660
LLPSGFSICR DAGIALVGSA EVT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002446214.10.0hypothetical protein SORBIDRAFT_06g004510
TrEMBLK3YDL50.0K3YDL5_SETIT; Uncharacterized protein
STRINGSi012320m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83241742
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.19e-82protodermal factor 2